Lineage for d2a33a1 (2a33 A:8-190)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) 
Family c.129.1.1: MoCo carrier protein-like [102406] (7 proteins)
Pfam PF03641Protein Hypothetical protein At2g37210/T2N18.3 [142344] (1 species) Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142345] (2 PDB entries)
Uniprot Q8L8B8 8-190
Domain d2a33a1: 2a33 A:8-190 [126070]
complexed with mg, so4
Details for d2a33a1
PDB Entry: 2a33 (more details), 1.95 Å
PDB Description: x-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at2g37210
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d2a33a1:
Sequence, based on SEQRES records: (download)
>d2a33a1 c.129.1.1 (A:8-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhd
ggrhvigiipktlmpreltgetvgevravadmhqrkaemakhsdafialpggygtleell
evitwaqlgihdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkk
lee
Sequence, based on observed residues (ATOM records): (download)
>d2a33a1 c.129.1.1 (A:8-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhd
ggrhvigiipktlmvgevravadmhqrkaemakhsdafialpggygtleellevitwaql
gihdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkklee
SCOPe Domain Coordinates for d2a33a1:
Click to download the PDB-style file with coordinates for d2a33a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2a33a1:
- d2a33a1 first appeared in SCOP 1.73
- d2a33a1 appears in SCOPe 2.07
View in 3D
