SCOP 1.75: Domain d2a2ra1: 2a2r A:78-209

Lineage for d2a2ra1 (2a2r A:78-209)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries)

8. Domain d2a2ra1: 2a2r A:78-209 [126058]
   Other proteins in same PDB: d2a2ra2, d2a2rb2
   automatically matched to d10gsa1
   complexed with ca, co3, gsn, mes

Details for d2a2ra1

PDB Entry: 2a2r, 1.4 Å

PDB Description: Crystal Structure of Glutathione Transferase Pi in complex with S-nitrosoglutathione

PDB Compounds: (A:) Glutathione S-transferase P

SCOP Domain Sequences for d2a2ra1:

Sequence; same for both SEQRES and ATOM records:

>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
lygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnq
ggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspe
yvnlpingngkq

Timeline for d2a2ra1:

• d2a2ra1 first appeared in SCOP 1.73
  
• d2a2ra1 appears in SCOPe 2.01
  
• d2a2ra1 appears in the current release, SCOPe 2.08