| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.3: ETFP subunits [52432] (3 proteins) alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet |
| Protein automated matches [190188] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186927] (1 PDB entry) |
| Domain d2a1ub_: 2a1u B: [126018] Other proteins in same PDB: d2a1ua1, d2a1ua2 automated match to d1efvb_ complexed with amp, fad; mutant |
PDB Entry: 2a1u (more details), 2.11 Å
SCOPe Domain Sequences for d2a1ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1ub_ c.26.2.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkveraidggletlrlklpavvta
dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkvette
dlvaklkeigri
Timeline for d2a1ub_: