SCOP 1.73: Domain d2a1ub1: 2a1u B:4-250

Lineage for d2a1ub1 (2a1u B:4-250)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (2 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Small, beta subunit of electron transfer flavoprotein ETFP [81394] (3 species)
   binds AMP

7. Species Human (Homo sapiens) [TaxId:9606] [81390] (4 PDB entries)

8. Domain d2a1ub1: 2a1u B:4-250 [126018]
   Other proteins in same PDB: d2a1ua1, d2a1ua2
   automatically matched to 2A1T S:3-250
   complexed with amp, fad; mutant

Details for d2a1ub1

PDB Entry: 2a1u, 2.11 Å

PDB Description: crystal structure of the human etf e165betaa mutant

PDB Compounds: (B:) Electron transfer flavoprotein beta-subunit

SCOP Domain Sequences for d2a1ub1:

Sequence; same for both SEQRES and ATOM records:

>d2a1ub1 c.26.2.3 (B:4-250) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]}
lrvlvavkrvidyavkirvkpdrtgvvtdgvkhsmnpfceiaveeavrlkekklvkevia
vscgpaqcqetirtalamgadrgihvevppaeaerlgplqvarvlaklaekekvdlvllg
kqaidddcnqtgqmtagfldwpqgtfasqvtlegdklkveraidggletlrlklpavvta
dlrlnepryatlpnimkakkkkievikpgdlgvdltsklsvisvedppqrtagvkvette
dlvaklk

Timeline for d2a1ub1:

• d2a1ub1 is new in SCOP 1.73
  
• d2a1ub1 appears in SCOP 1.75
  
• d2a1ub1 appears in the current release, SCOPe 2.08, called d2a1ub_