Lineage for d2a1jb1 (2a1j B:219-296)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493577Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 1493632Family a.60.2.5: Hef domain-like [140629] (4 proteins)
    helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)
  6. 1493637Protein DNA excision repair protein ERCC-1 [140630] (1 species)
  7. 1493638Species Human (Homo sapiens) [TaxId:9606] [140631] (2 PDB entries)
    Uniprot P07992 219-296! Uniprot P07992 220-297
  8. 1493639Domain d2a1jb1: 2a1j B:219-296 [126001]
    Other proteins in same PDB: d2a1ja1
    protein/DNA complex; complexed with hg

Details for d2a1jb1

PDB Entry: 2a1j (more details), 2.7 Å

PDB Description: Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1
PDB Compounds: (B:) DNA excision repair protein ERCC-1

SCOPe Domain Sequences for d2a1jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
padllmekleqdfvsrvteclttvksvnktdsqtllttfgsleqliaasredlalcpglg
pqkarrlfdvlhepflkv

SCOPe Domain Coordinates for d2a1jb1:

Click to download the PDB-style file with coordinates for d2a1jb1.
(The format of our PDB-style files is described here.)

Timeline for d2a1jb1: