Lineage for d2a1be_ (2a1b E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562704Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2562705Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2562706Protein Carboxysome shell protein CcmK2 [143420] (2 species)
  7. 2562707Species Synechocystis sp. PCC 6803 [TaxId:1148] [143421] (1 PDB entry)
    Uniprot P72761 1-101
  8. 2562712Domain d2a1be_: 2a1b E: [125981]
    automated match to d2a1ba1

Details for d2a1be_

PDB Entry: 2a1b (more details), 2.9 Å

PDB Description: carboxysome shell protein ccmk2
PDB Compounds: (E:) Carbon dioxide concentrating mechanism protein ccmK homolog 2

SCOPe Domain Sequences for d2a1be_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1be_ d.58.56.1 (E:) Carboxysome shell protein CcmK2 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
siavgmietrgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsgvqasvsagi
eaanrvnggevlsthiiarphenleyvlpiryteeveqfrt

SCOPe Domain Coordinates for d2a1be_:

Click to download the PDB-style file with coordinates for d2a1be_.
(The format of our PDB-style files is described here.)

Timeline for d2a1be_: