Lineage for d1zz7b1 (1zz7 B:7-76)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709427Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 2709428Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. 2709434Domain d1zz7b1: 1zz7 B:7-76 [125878]
    Other proteins in same PDB: d1zz7a2, d1zz7b2
    automated match to d1zz6a1
    complexed with fe2, s0h

Details for d1zz7b1

PDB Entry: 1zz7 (more details), 2.1 Å

PDB Description: Crystal Structure of FeII HppE in Complex with Substrate form 1
PDB Compounds: (B:) Hydroxyprophylphosphonic Acid Epoxidase

SCOPe Domain Sequences for d1zz7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zz7b1 a.35.1.3 (B:7-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
astgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgts
igaltppagn

SCOPe Domain Coordinates for d1zz7b1:

Click to download the PDB-style file with coordinates for d1zz7b1.
(The format of our PDB-style files is described here.)

Timeline for d1zz7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zz7b2