| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
| Family a.4.13.0: automated matches [254211] (1 protein) not a true family |
| Protein automated matches [254475] (4 species) not a true protein |
| Species Thermus thermophilus [TaxId:274] [255021] (2 PDB entries) |
| Domain d1zyrp1: 1zyr P:258-318 [125866] Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf3, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp3 automated match to d1smyf1 protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 1zyr (more details), 3 Å
SCOPe Domain Sequences for d1zyrp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyrp1 a.4.13.0 (P:258-318) automated matches {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e
Timeline for d1zyrp1: