SCOP 1.73: Domain d1zyra1: 1zyr A:1-49,A:173-229

Lineage for d1zyra1 (1zyr A:1-49,A:173-229)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.74: DCoH-like [55247] (4 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (9 PDB entries)

8. Domain d1zyra1: 1zyr A:1-49,A:173-229 [125849]
   Other proteins in same PDB: d1zyra2, d1zyrb2, d1zyrc1, d1zyrd1, d1zyre1, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk2, d1zyrl2, d1zyrm1, d1zyrn1, d1zyro1, d1zyrp1, d1zyrp2, d1zyrp3
   automatically matched to d1iw7a1
   complexed with mg, std, zn

Details for d1zyra1

PDB Entry: 1zyr, 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin

PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d1zyra1:

Sequence; same for both SEQRES and ATOM records:

>d1zyra1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

Timeline for d1zyra1:

• d1zyra1 is new in SCOP 1.73
  
• d1zyra1 appears in SCOP 1.75
  
• d1zyra1 appears in the current release, SCOPe 2.08