Lineage for d1zyra2 (1zyr A:50-172)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739032Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 739033Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 739034Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 739035Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 739050Species Thermus thermophilus [TaxId:274] [75595] (9 PDB entries)
  8. 739079Domain d1zyra2: 1zyr A:50-172 [125850]
    Other proteins in same PDB: d1zyra1, d1zyrb1, d1zyrc1, d1zyrd1, d1zyre1, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrl1, d1zyrm1, d1zyrn1, d1zyro1, d1zyrp1, d1zyrp2, d1zyrp3
    automatically matched to d1iw7a2
    complexed with mg, std, zn

Details for d1zyra2

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d1zyra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyra2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOP Domain Coordinates for d1zyra2:

Click to download the PDB-style file with coordinates for d1zyra2.
(The format of our PDB-style files is described here.)

Timeline for d1zyra2: