Lineage for d1zyka1 (1zyk A:1-70)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327502Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2327513Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2327514Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2327515Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 2327523Species Sulfolobus solfataricus [TaxId:2287] [81775] (7 PDB entries)
  8. 2327532Domain d1zyka1: 1zyk A:1-70 [125830]
    Other proteins in same PDB: d1zyka2, d1zykb2, d1zykc2, d1zykd2
    automated match to d1o17c1
    complexed with be2, mg, prp

Details for d1zyka1

PDB Entry: 1zyk (more details), 2.4 Å

PDB Description: anthranilate phosphoribosyltransferase in complex with prpp, anthranilate and magnesium
PDB Compounds: (A:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1zyka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyka1 a.46.2.1 (A:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

SCOPe Domain Coordinates for d1zyka1:

Click to download the PDB-style file with coordinates for d1zyka1.
(The format of our PDB-style files is described here.)

Timeline for d1zyka1: