SCOPe 2.04: Domain d1zxyb1: 1zxy B:1-70

Lineage for d1zxyb1 (1zxy B:1-70)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [81775] (6 PDB entries)

8. Domain d1zxyb1: 1zxy B:1-70 [125805]
   Other proteins in same PDB: d1zxya2, d1zxyb2, d1zxyc2, d1zxyd2
   automated match to d1o17c1
   complexed with mg, prp

Details for d1zxyb1

PDB Entry: 1zxy, 2.56 Å

PDB Description: anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium

PDB Compounds: (B:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1zxyb1:

Sequence; same for both SEQRES and ATOM records:

>d1zxyb1 a.46.2.1 (B:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]}
mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar
amrelaikid

Timeline for d1zxyb1:

• d1zxyb1 first appeared in SCOP 1.73
  
• d1zxyb1 appears in SCOPe 2.03
  
• d1zxyb1 appears in SCOPe 2.05
  
• d1zxyb1 appears in the current release, SCOPe 2.08