![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
![]() | Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
![]() | Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [81775] (6 PDB entries) |
![]() | Domain d1zxyb1: 1zxy B:1-70 [125805] Other proteins in same PDB: d1zxya2, d1zxyb2, d1zxyc2, d1zxyd2 automated match to d1o17c1 complexed with mg, prp |
PDB Entry: 1zxy (more details), 2.56 Å
SCOPe Domain Sequences for d1zxyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxyb1 a.46.2.1 (B:1-70) Anthranilate phosphoribosyltransferase (TrpD) {Sulfolobus solfataricus [TaxId: 2287]} mnineilkklinksdleineaeelakaiirgevpeilvsailvalrmkgeskneivgfar amrelaikid
Timeline for d1zxyb1: