Lineage for d1zwla_ (1zwl A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587349Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1587741Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 1587750Protein Trp repressor binding protein WrbA [117475] (3 species)
  7. 1587775Species Pseudomonas aeruginosa [TaxId:287] [142053] (3 PDB entries)
    Uniprot Q9I509 3-198! Uniprot Q9I509 4-196
  8. 1587777Domain d1zwla_: 1zwl A: [125747]
    automated match to d2a5la1
    complexed with fmn

Details for d1zwla_

PDB Entry: 1zwl (more details), 2.8 Å

PDB Description: structure of wrba from pseudomonas aeruginosa in complex with fmn
PDB Compounds: (A:) Trp repressor binding protein WrbA

SCOPe Domain Sequences for d1zwla_:

Sequence, based on SEQRES records: (download)

>d1zwla_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
pyilvlyysrhgataemarqiargveqggfearvrtvpavsteceavapdipaegalyat
ledlkncaglalgsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqe
ttqlsmllpllhhgmlvlgipysepalletrgggtpygashfagadgkrsldeheltlcr
algkrlaetagkle

Sequence, based on observed residues (ATOM records): (download)

>d1zwla_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Pseudomonas aeruginosa [TaxId: 287]}
pyilvlyysrhgataemarqiargveqggfearvrtvpavstgalyatledlkncaglal
gsptrfgnmasplkyfldgtsslwltgslvgkpaavftstaslhggqettqlsmllpllh
hgmlvlgipyggtpygashfagadgkrsldeheltlcralgkrlaetagkle

SCOPe Domain Coordinates for d1zwla_:

Click to download the PDB-style file with coordinates for d1zwla_.
(The format of our PDB-style files is described here.)

Timeline for d1zwla_: