SCOPe 2.08: Domain d1zuea1: 1zue A:1-42

Lineage for d1zuea1 (1zue A:1-42)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.9: Defensin-like [57391] (1 superfamily)
   Disulfide-rich fold, nearly all-beta

4. Superfamily g.9.1: Defensin-like [57392] (3 families)

5. Family g.9.1.1: Defensin [57393] (11 proteins)

6. Protein Defensin-like peptide, DLP [57400] (2 species)

7. Species Duckbilled platypus (Ornithorhynchus anatinus), DLP-2 [TaxId:9258] [57402] (3 PDB entries)

8. Domain d1zuea1: 1zue A:1-42 [125670]
   automatically matched to d1d6ba_

Details for d1zuea1

PDB Entry: 1zue

PDB Description: revised solution structure of dlp-2

PDB Compounds: (A:) Defensin-like peptide 2/4

SCOPe Domain Sequences for d1zuea1:

Sequence; same for both SEQRES and ATOM records:

>d1zuea1 g.9.1.1 (A:1-42) Defensin-like peptide, DLP {Duckbilled platypus (Ornithorhynchus anatinus), DLP-2 [TaxId: 9258]}
ixffemqacwshsgvcrdksernckpmawtycenrnqkccey

Timeline for d1zuea1:

• d1zuea1 first appeared in SCOP 1.73
  
• d1zuea1 appears in SCOPe 2.07