Lineage for d1zuea1 (1zue A:1-42)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032898Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 3032899Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 3032900Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 3032963Protein Defensin-like peptide, DLP [57400] (2 species)
  7. 3032966Species Duckbilled platypus (Ornithorhynchus anatinus), DLP-2 [TaxId:9258] [57402] (3 PDB entries)
  8. 3032967Domain d1zuea1: 1zue A:1-42 [125670]
    automatically matched to d1d6ba_

Details for d1zuea1

PDB Entry: 1zue (more details)

PDB Description: revised solution structure of dlp-2
PDB Compounds: (A:) Defensin-like peptide 2/4

SCOPe Domain Sequences for d1zuea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zuea1 g.9.1.1 (A:1-42) Defensin-like peptide, DLP {Duckbilled platypus (Ornithorhynchus anatinus), DLP-2 [TaxId: 9258]}
ixffemqacwshsgvcrdksernckpmawtycenrnqkccey

SCOPe Domain Coordinates for d1zuea1:

Click to download the PDB-style file with coordinates for d1zuea1.
(The format of our PDB-style files is described here.)

Timeline for d1zuea1: