Lineage for d1ztcd_ (1ztc D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1046299Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1046300Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1046583Family d.157.1.11: TM0894-like [143930] (1 protein)
    part of Pfam PF00753
  6. 1046584Protein Hypothetical protein TM0894 [143931] (1 species)
  7. 1046585Species Thermotoga maritima [TaxId:2336] [143932] (1 PDB entry)
    Uniprot Q9WZZ6 1-207
  8. 1046589Domain d1ztcd_: 1ztc D: [125638]
    automated match to d1ztca1
    complexed with mpd, ni, po4

Details for d1ztcd_

PDB Entry: 1ztc (more details), 2.1 Å

PDB Description: crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution
PDB Compounds: (D:) hypothetical protein TM0894

SCOPe Domain Sequences for d1ztcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztcd_ d.157.1.11 (D:) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]}
hhmelkilvtggnvfvpgrlnahfstvvylehkdrriiidpgnlssmdeleekfselgis
pdditdvlfthvhldhifnsvlfenatfyvhevyktknylsfgtivgriyskvisswknv
vllkgeeslfdekvkvfhtpwharehlsflldtenagrvlitgditpnrlsyydiikgyg
svqvknfldrvgridllvfphdaplkpe

SCOPe Domain Coordinates for d1ztcd_:

Click to download the PDB-style file with coordinates for d1ztcd_.
(The format of our PDB-style files is described here.)

Timeline for d1ztcd_: