![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein) N-terminal half of Pfam PF02016 |
![]() | Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries) Uniprot Q9HTZ1 3-169! Uniprot Q9HTZ1 5-142! Uniprot Q9HTZ1 5-169 |
![]() | Domain d1zrsa2: 1zrs A:5-169 [125557] Other proteins in same PDB: d1zrsa1, d1zrsb1 |
PDB Entry: 1zrs (more details), 1.5 Å
SCOP Domain Sequences for d1zrsa2:
Sequence, based on SEQRES records: (download)
>d1zrsa2 c.23.16.7 (A:5-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} pssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtve qrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsaf hrhglpaihgpvatglglsplsapreqqerlaslasvsrllagid
>d1zrsa2 c.23.16.7 (A:5-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} pssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtve qrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsaf hrhglpaihgpvatglglqerlaslasvsrllagid
Timeline for d1zrsa2: