Lineage for d1zrsa2 (1zrs A:5-169)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692818Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 693098Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein)
    N-terminal half of Pfam PF02016
  6. 693099Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species)
  7. 693100Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries)
  8. 693103Domain d1zrsa2: 1zrs A:5-169 [125557]
    Other proteins in same PDB: d1zrsa1, d1zrsb1

Details for d1zrsa2

PDB Entry: 1zrs (more details), 1.5 Å

PDB Description: wild-type LD-carboxypeptidase
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d1zrsa2:

Sequence, based on SEQRES records: (download)

>d1zrsa2 c.23.16.7 (A:5-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
pssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtve
qrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsaf
hrhglpaihgpvatglglsplsapreqqerlaslasvsrllagid

Sequence, based on observed residues (ATOM records): (download)

>d1zrsa2 c.23.16.7 (A:5-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
pssdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtve
qrledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsaf
hrhglpaihgpvatglglqerlaslasvsrllagid

SCOP Domain Coordinates for d1zrsa2:

Click to download the PDB-style file with coordinates for d1zrsa2.
(The format of our PDB-style files is described here.)

Timeline for d1zrsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zrsa1