Lineage for d1zq1d2 (1zq1 D:277-407)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524493Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2524785Superfamily d.74.4: GAD domain-like [55261] (2 families) (S)
  5. 2524786Family d.74.4.1: GAD domain [55262] (2 proteins)
    has additional structures inserted in the common fold loops
  6. 2524787Protein Glutamyl-tRNA(gln) amidotransferase subunit E, GatE, insert domain [143513] (2 species)
  7. 2524791Species Pyrococcus abyssi [TaxId:29292] [143515] (1 PDB entry)
    Uniprot Q9V0U0 277-407
  8. 2524793Domain d1zq1d2: 1zq1 D:277-407 [125497]
    Other proteins in same PDB: d1zq1a1, d1zq1a2, d1zq1b1, d1zq1b2, d1zq1c1, d1zq1c3, d1zq1d1, d1zq1d3
    automatically matched to 1ZQ1 C:277-407
    complexed with asp

Details for d1zq1d2

PDB Entry: 1zq1 (more details), 3 Å

PDB Description: Structure of GatDE tRNA-Dependent Amidotransferase from Pyrococcus abyssi
PDB Compounds: (D:) Glutamyl-tRNA(Gln) amidotransferase subunit E

SCOPe Domain Sequences for d1zq1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq1d2 d.74.4.1 (D:277-407) Glutamyl-tRNA(gln) amidotransferase subunit E, GatE, insert domain {Pyrococcus abyssi [TaxId: 29292]}
vkpkdikeefydvtdifentkskiiarvikkggkvlaiklpkfrgligreiqpgrrlgte
fadrakkyvpgifhidelpnygisqeevnkvierlnlseedafvlvaaeeekaknalrev
ikrareaiegv

SCOPe Domain Coordinates for d1zq1d2:

Click to download the PDB-style file with coordinates for d1zq1d2.
(The format of our PDB-style files is described here.)

Timeline for d1zq1d2: