Lineage for d1zq1c1 (1zq1 C:457-512)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014330Fold a.182: GatB/YqeY motif [89094] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical)
  4. 2014331Superfamily a.182.1: GatB/YqeY motif [89095] (2 families) (S)
  5. 2014336Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 protein domains)
    assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure
  6. 2014344Protein Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain [140760] (2 species)
  7. 2014348Species Pyrococcus abyssi [TaxId:29292] [140762] (1 PDB entry)
    Uniprot Q9V0U0 457-512
  8. 2014349Domain d1zq1c1: 1zq1 C:457-512 [125493]
    Other proteins in same PDB: d1zq1a1, d1zq1a2, d1zq1b1, d1zq1b2, d1zq1c2, d1zq1c3, d1zq1d2, d1zq1d3
    complexed with asp

Details for d1zq1c1

PDB Entry: 1zq1 (more details), 3 Å

PDB Description: Structure of GatDE tRNA-Dependent Amidotransferase from Pyrococcus abyssi
PDB Compounds: (C:) Glutamyl-tRNA(Gln) amidotransferase subunit E

SCOPe Domain Sequences for d1zq1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zq1c1 a.182.1.2 (C:457-512) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Pyrococcus abyssi [TaxId: 29292]}
elpqakveryvkeykldrslaqtlvdderdelfeelvsmgvkpslaasilvvvlkg

SCOPe Domain Coordinates for d1zq1c1:

Click to download the PDB-style file with coordinates for d1zq1c1.
(The format of our PDB-style files is described here.)

Timeline for d1zq1c1: