![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.182: GatB/YqeY motif [89094] (1 superfamily) multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical) |
![]() | Superfamily a.182.1: GatB/YqeY motif [89095] (2 families) ![]() |
![]() | Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 proteins) assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure |
![]() | Protein Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain [140760] (2 species) |
![]() | Species Pyrococcus abyssi [TaxId:29292] [140762] (1 PDB entry) Uniprot Q9V0U0 457-512 |
![]() | Domain d1zq1d1: 1zq1 D:457-512 [125496] Other proteins in same PDB: d1zq1a1, d1zq1a2, d1zq1b1, d1zq1b2, d1zq1c2, d1zq1c3, d1zq1d2, d1zq1d3 automatically matched to 1ZQ1 C:457-512 complexed with asp |
PDB Entry: 1zq1 (more details), 3 Å
SCOPe Domain Sequences for d1zq1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zq1d1 a.182.1.2 (D:457-512) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Pyrococcus abyssi [TaxId: 29292]} elpqakveryvkeykldrslaqtlvdderdelfeelvsmgvkpslaasilvvvlkg
Timeline for d1zq1d1: