Lineage for d1zpyb1 (1zpy B:4-93)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766942Family a.25.1.5: half-ferritin [140450] (1 protein)
    comprise of alpha-hairpin subunits forming the ferritin-like four-helical bundle; assembles further in a homodecamer
  6. 766943Protein Hypothetical protein NE0167 [140451] (1 species)
  7. 766944Species Nitrosomonas europaea [TaxId:915] [140452] (1 PDB entry)
    Uniprot Q82XT5 4-94
  8. 766946Domain d1zpyb1: 1zpy B:4-93 [125480]
    automatically matched to 1ZPY A:4-94

Details for d1zpyb1

PDB Entry: 1zpy (more details), 2.2 Å

PDB Description: Crystal structure of protein NE0167 from Nitrosomonas europaea
PDB Compounds: (B:) hypothetical protein NE0167

SCOP Domain Sequences for d1zpyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpyb1 a.25.1.5 (B:4-93) Hypothetical protein NE0167 {Nitrosomonas europaea [TaxId: 915]}
dgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekeh
aamllewirrcdpafdkelkdylftnkpia

SCOP Domain Coordinates for d1zpyb1:

Click to download the PDB-style file with coordinates for d1zpyb1.
(The format of our PDB-style files is described here.)

Timeline for d1zpyb1: