SCOP 1.75: Domain d1znka1: 1znk A:1-157

Lineage for d1znka1 (1znk A:1-157)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (9 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50833] (19 PDB entries)

8. Domain d1znka1: 1znk A:1-157 [125384]
   automatically matched to d1df3a_
   complexed with cd, f09

Details for d1znka1

PDB Entry: 1znk, 1.6 Å

PDB Description: Strong Solute-Solute Dispersive Interactions in a Protein-Ligand Complex

PDB Compounds: (A:) major urinary protein

SCOP Domain Sequences for d1znka1:

Sequence; same for both SEQRES and ATOM records:

>d1znka1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
grepdlssdikerfaqlceehgilreniidlsnanrc

Timeline for d1znka1:

• d1znka1 first appeared in SCOP 1.73
  
• d1znka1 is called d1znka_ in SCOPe 2.01
  
• d1znka1 appears in the current release, SCOPe 2.08, called d1znka_