Lineage for d1znka1 (1znk A:1-157)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673734Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)
  7. 673735Species Mouse (Mus musculus) [TaxId:10090] [50833] (18 PDB entries)
  8. 673739Domain d1znka1: 1znk A:1-157 [125384]
    automatically matched to d1df3a_
    complexed with cd, f09

Details for d1znka1

PDB Entry: 1znk (more details), 1.6 Å

PDB Description: Strong Solute-Solute Dispersive Interactions in a Protein-Ligand Complex
PDB Compounds: (A:) major urinary protein

SCOP Domain Sequences for d1znka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znka1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
grepdlssdikerfaqlceehgilreniidlsnanrc

SCOP Domain Coordinates for d1znka1:

Click to download the PDB-style file with coordinates for d1znka1.
(The format of our PDB-style files is described here.)

Timeline for d1znka1: