![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Adenine PRTase [53288] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102536] (16 PDB entries) |
![]() | Domain d1zn7b_: 1zn7 B: [125375] automated match to d1orea_ complexed with ade, hsx, mg, po4, prp |
PDB Entry: 1zn7 (more details), 1.83 Å
SCOPe Domain Sequences for d1zn7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zn7b_ c.61.1.1 (B:) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye
Timeline for d1zn7b_: