SCOP 1.73: Domain d1zn7b1: 1zn7 B:3-180

Lineage for d1zn7b1 (1zn7 B:3-180)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)

6. Protein Adenine PRTase [53288] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102536] (4 PDB entries)

8. Domain d1zn7b1: 1zn7 B:3-180 [125375]
   automatically matched to d1orea_
   complexed with ade, mg, po4, prp, rp5

Details for d1zn7b1

PDB Entry: 1zn7, 1.83 Å

PDB Description: human adenine phosphoribosyltransferase complexed with prpp, ade and r5p

PDB Compounds: (B:) Adenine phosphoribosyltransferase

SCOP Domain Sequences for d1zn7b1:

Sequence; same for both SEQRES and ATOM records:

>d1zn7b1 c.61.1.1 (B:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]}
dselqlveqrirsfpdfptpgvvfrdispvlkdpasfraaigllarhlkathggridyia
gldsrgflfgpslaqelglgcvlirkrgklpgptlwasysleygkaeleiqkdalepgqr
vvvvddllatggtmnaacellgrlqaevlecvslveltslkgreklapvpffsllqye

Timeline for d1zn7b1:

• d1zn7b1 is new in SCOP 1.73
  
• d1zn7b1 appears in SCOP 1.75
  
• d1zn7b1 appears in the current release, SCOPe 2.08, called d1zn7b_