SCOPe 2.02: Domain d1zlah_: 1zla H:

Lineage for d1zlah_ (1zla H:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (35 PDB entries)

8. Domain d1zlah_: 1zla H: [125247]
   Other proteins in same PDB: d1zlaa_, d1zlab_, d1zlac1, d1zlae_, d1zlaf_, d1zlag_
   automated match to d1kx5d_
   protein/DNA complex

Details for d1zlah_

PDB Entry: 1zla, 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core

PDB Compounds: (H:) histone h2b

SCOPe Domain Sequences for d1zlah_:

Sequence; same for both SEQRES and ATOM records:

>d1zlah_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d1zlah_:

• d1zlah_ first appeared in SCOP 1.73, called d1zlah1
  
• d1zlah_ was called d1zlah1 in SCOPe 2.01
  
• d1zlah_ appears in SCOPe 2.03
  
• d1zlah_ appears in the current release, SCOPe 2.08