Lineage for d1zlah_ (1zla H:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082716Protein Histone H2B [47119] (6 species)
  7. 1082717Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (35 PDB entries)
  8. 1082769Domain d1zlah_: 1zla H: [125247]
    Other proteins in same PDB: d1zlaa_, d1zlab_, d1zlac1, d1zlae_, d1zlaf_, d1zlag_
    automated match to d1kx5d_
    protein/DNA complex

Details for d1zlah_

PDB Entry: 1zla (more details), 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
PDB Compounds: (H:) histone h2b

SCOPe Domain Sequences for d1zlah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlah_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d1zlah_:

Click to download the PDB-style file with coordinates for d1zlah_.
(The format of our PDB-style files is described here.)

Timeline for d1zlah_: