Lineage for d1zkna_ (1zkn A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2349733Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2349797Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2349798Species Human (Homo sapiens) [TaxId:9606] [89152] (72 PDB entries)
    Uniprot Q08499 388-713
  8. 2349880Domain d1zkna_: 1zkn A: [125201]
    automated match to d1oyna_
    complexed with ibm, mg, zn

Details for d1zkna_

PDB Entry: 1zkn (more details), 2.1 Å

PDB Description: Structure of PDE4D2-IBMX
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d1zkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkna_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
plwetwadlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d1zkna_:

Click to download the PDB-style file with coordinates for d1zkna_.
(The format of our PDB-style files is described here.)

Timeline for d1zkna_: