SCOP 1.75: Domain d1zkga1: 1zkg A:2-75

Lineage for d1zkga1 (1zkg A:2-75)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Transcriptional regulator TM1030 [140209] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [140210] (4 PDB entries)
   Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75

8. Domain d1zkga1: 1zkg A:2-75 [125194]
   Other proteins in same PDB: d1zkga2, d1zkgb2
   complexed with unl

Details for d1zkga1

PDB Entry: 1zkg, 2.3 Å

PDB Description: Crystal structure of Transcriptional regulator, TETR family (tm1030) from Thermotoga maritima at 2.30 A resolution

PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOP Domain Sequences for d1zkga1:

Sequence; same for both SEQRES and ATOM records:

>d1zkga1 a.4.1.9 (A:2-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
lskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtek
lqkefenflmknrn

Timeline for d1zkga1:

• d1zkga1 first appeared in SCOP 1.73
  
• d1zkga1 appears in SCOPe 2.01
  
• d1zkga1 appears in the current release, SCOPe 2.08