Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins) |
Protein Transcriptional regulator TM1030 [140209] (1 species) |
Species Thermotoga maritima [TaxId:2336] [140210] (4 PDB entries) Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75 |
Domain d1zkga1: 1zkg A:2-75 [125194] Other proteins in same PDB: d1zkga2, d1zkgb2 complexed with unl |
PDB Entry: 1zkg (more details), 2.3 Å
SCOPe Domain Sequences for d1zkga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkga1 a.4.1.9 (A:2-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]} lskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtek lqkefenflmknrn
Timeline for d1zkga1: