SCOPe 2.07: Domain d1zhnb_: 1zhn B:

Lineage for d1zhnb_ (1zhn B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1zhnb_: 1zhn B: [125107]
   Other proteins in same PDB: d1zhna1, d1zhna2
   automated match to d1bz9b_
   complexed with gol, nag, pc6

Details for d1zhnb_

PDB Entry: 1zhn, 2.8 Å

PDB Description: crystal structure of mouse cd1d bound to the self ligand phosphatidylcholine

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1zhnb_:

Sequence; same for both SEQRES and ATOM records:

>d1zhnb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1zhnb_:

• d1zhnb_ first appeared in SCOP 1.73, called d1zhnb1
  
• d1zhnb_ appears in SCOPe 2.06
  
• d1zhnb_ appears in the current release, SCOPe 2.08