SCOPe 2.08: Domain d1zhbd1: 1zhb D:182-274

Lineage for d1zhbd1 (1zhb D:182-274)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
   Uniprot P01901 22-299

8. Domain d1zhbd1: 1zhb D:182-274 [125084]
   Other proteins in same PDB: d1zhba2, d1zhbb_, d1zhbd2, d1zhbe_, d1zhbg2, d1zhbh_, d1zhbj2, d1zhbk_
   automatically matched to d1ddha1

Details for d1zhbd1

PDB Entry: 1zhb, 2.7 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase

PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1zhbd1:

Sequence; same for both SEQRES and ATOM records:

>d1zhbd1 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d1zhbd1:

• d1zhbd1 first appeared in SCOP 1.73
  
• d1zhbd1 appears in SCOPe 2.07