Lineage for d1zhbg1 (1zhb G:182-274)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2021514Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2021804Species Mouse (Mus musculus) [TaxId:10090] [88606] (104 PDB entries)
    Uniprot P01901 22-299
  8. 2021905Domain d1zhbg1: 1zhb G:182-274 [125087]
    Other proteins in same PDB: d1zhba2, d1zhbb_, d1zhbd2, d1zhbe_, d1zhbg2, d1zhbh_, d1zhbj2, d1zhbk_
    automatically matched to d1ddha1

Details for d1zhbg1

PDB Entry: 1zhb (more details), 2.7 Å

PDB Description: Crystal Structure Of The Murine Class I Major Histocompatibility Complex Of H-2Db, B2-Microglobulin, and a 9-Residue Peptide Derived from rat dopamine beta-monooxigenase
PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1zhbg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhbg1 b.1.1.2 (G:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOPe Domain Coordinates for d1zhbg1:

Click to download the PDB-style file with coordinates for d1zhbg1.
(The format of our PDB-style files is described here.)

Timeline for d1zhbg1: