SCOPe 2.07: Domain d1zh8a1: 1zh8 A:4-131,A:276-328

Lineage for d1zh8a1 (1zh8 A:4-131,A:276-328)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Hypothetical protein TM0312 [141925] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141926] (1 PDB entry)
   Uniprot Q9WYE8 4-131,276-328

8. Domain d1zh8a1: 1zh8 A:4-131,A:276-328 [125077]
   Other proteins in same PDB: d1zh8a2, d1zh8b2
   complexed with edo, na, nap

Details for d1zh8a1

PDB Entry: 1zh8, 2.5 Å

PDB Description: Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution

PDB Compounds: (A:) Oxidoreductase

SCOPe Domain Sequences for d1zh8a1:

Sequence; same for both SEQRES and ATOM records:

>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]}
lrkirlgivgcgiaarelhlpalknlshlfeitavtsrtrshaeefakmvgnpavfdsye
ellesglvdavdltlpvelnlpfiekalrkgvhvicekpistdvetgkkvvelseksekt
vyiaenfrXensyqkefedfyqvvaegkpndlgspvqalkdlafieacvrsagnkvfvss
ll

Timeline for d1zh8a1:

• d1zh8a1 first appeared in SCOP 1.73
  
• d1zh8a1 appears in SCOPe 2.06
  
• d1zh8a1 appears in the current release, SCOPe 2.08