SCOPe 2.08: Domain d1zdsb1: 1zds B:4-161

Lineage for d1zdsb1 (1zds B:4-161)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)

8. Domain d1zdsb1: 1zds B:4-161 [124954]
   automated match to d3h4fa1
   complexed with acm, cu

Details for d1zdsb1

PDB Entry: 1zds, 1.55 Å

PDB Description: crystal structure of met150gly afnir with acetamide bound

PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1zdsb1:

Sequence; same for both SEQRES and ATOM records:

>d1zdsb1 b.6.1.0 (B:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsggngaimvlpreg

Timeline for d1zdsb1:

• d1zdsb1 first appeared in SCOP 1.73
  
• d1zdsb1 appears in SCOPe 2.07