Lineage for d1zdsa2 (1zds A:162-339)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. Protein automated matches [190824] (31 species)
    not a true protein
  7. Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries)
  8. Domain d1zdsa2: 1zds A:162-339 [124953]
    automated match to d3h4fa2
    complexed with acm, cu

Details for d1zdsa2

PDB Entry: 1zds (more details), 1.55 Å

PDB Description: Crystal Structure of Met150Gly AfNiR with Acetamide Bound
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d1zdsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdsa2 b.6.1.0 (A:162-339) automated matches {Alcaligenes faecalis [TaxId: 511]}
lhdgkgkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfn
gavgaltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetw
fipggaagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

SCOPe Domain Coordinates for d1zdsa2 are not available.

Timeline for d1zdsa2:

Domains from same chain:
(mouse over for more information)
d1zdsa1
Domains from other chains:
(mouse over for more information)
d1zdsb1, d1zdsb2, d1zdsc1, d1zdsc2