Lineage for d1zd0a1 (1zd0 A:9-144)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741915Fold d.329: PF0523-like [143869] (1 superfamily)
    beta-alpha-beta-alpha(3)-beta-alpha-beta-alpha; 3 layers, a/b/a; antiparallel beta-sheet, order 4132; some similarity to the PurM C-terminal domain-like fold (scop_cf 56041)
  4. 741916Superfamily d.329.1: PF0523-like [143870] (1 family) (S)
  5. 741917Family d.329.1.1: PF0523-like [143871] (1 protein)
    Pfam PF04416; DUF509
  6. 741918Protein Hypothetical protein PF0523 [143872] (1 species)
  7. 741919Species Pyrococcus furiosus [TaxId:2261] [143873] (1 PDB entry)
  8. 741920Domain d1zd0a1: 1zd0 A:9-144 [124927]
    complexed with mg, moh, unx

Details for d1zd0a1

PDB Entry: 1zd0 (more details), 1.7 Å

PDB Description: crystal structure of pfu-542154 conserved hypothetical protein
PDB Compounds: (A:) hypothetical protein PF0523

SCOP Domain Sequences for d1zd0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zd0a1 d.329.1.1 (A:9-144) Hypothetical protein PF0523 {Pyrococcus furiosus [TaxId: 2261]}
leirtkvgeiciskvwltdeqinklfdrfkgdyqvvnaecadkvifatiiaikavkegrs
iaktvpgeilvrlsgnrqikeaikkvgakegenyivtfgenasallqkilstleikelel
ercdleyakkafedia

SCOP Domain Coordinates for d1zd0a1:

Click to download the PDB-style file with coordinates for d1zd0a1.
(The format of our PDB-style files is described here.)

Timeline for d1zd0a1: