PDB entry 1zd0

View 1zd0 on RCSB PDB site
Description: Crystal structure of Pfu-542154 conserved hypothetical protein
Class: structural genomics, unknown function
Keywords: Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2005-04-13, released 2005-05-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.202
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PF0523
    Species: Pyrococcus furiosus
    Gene: PF0523
    Database cross-references and differences (RAF-indexed):
    • GB NP_578252 (9-End)
      • his tag (4-6)
      • cloning artifact (7-8)
    Domains in SCOP 1.73: d1zd0a1
  • Heterogens: MG, UNX, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1zd0A (A:)
ahhhhhhgsleirtkvgeiciskvwltdeqinklfdrfkgdyqvvnaecadkvifatiia
ikavkegrsiaktvpgeilvrlsgnrqikeaikkvgakegenyivtfgenasallqkils
tleikelelercdleyakkafediaiieal

    Sequence, based on observed residues (ATOM records): (download) 
    >1zd0A (A:)
hhhgsleirtkvgeiciskvwltdeqinklfdrfkgdyqvvnaecadkvifatiiaikav
kegrsiaktvpgeilvrlsgnrqikeaikkvgakegenyivtfgenasallqkilstlei
kelelercdleyakkafedia