Lineage for d1zcaa1 (1zca A:83-204)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273392Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 1273393Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 1273394Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 1273395Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 1273435Species Mouse (Mus musculus) [TaxId:10090] [140674] (5 PDB entries)
    Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201
  8. 1273440Domain d1zcaa1: 1zca A:83-204 [124897]
    Other proteins in same PDB: d1zcaa2, d1zcab2
    G alpha i/12
    complexed with alf, gdp, mg

Details for d1zcaa1

PDB Entry: 1zca (more details), 2.9 Å

PDB Description: crystal structure of g alpha 12 in complex with gdp, mg2+ and alf4-
PDB Compounds: (A:) G alpha i/12

SCOPe Domain Sequences for d1zcaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
fdqkallefrdtifdnilkgsrvlvdardklgipwqhsenekhgmflmafenkaglpvep
atfqlyvpalsalwrdsgireafsrrsefqlgesvkyfldnldrigqlnyfpskqdilla
rk

SCOPe Domain Coordinates for d1zcaa1:

Click to download the PDB-style file with coordinates for d1zcaa1.
(The format of our PDB-style files is described here.)

Timeline for d1zcaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zcaa2