SCOPe 2.08: Domain d1zcaa1: 1zca A:83-204

Lineage for d1zcaa1 (1zca A:83-204)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140674] (5 PDB entries)
   Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201

8. Domain d1zcaa1: 1zca A:83-204 [124897]
   Other proteins in same PDB: d1zcaa2, d1zcab2
   G alpha i/12
   complexed with alf, gdp, mg

Details for d1zcaa1

PDB Entry: 1zca, 2.9 Å

PDB Description: crystal structure of g alpha 12 in complex with gdp, mg2+ and alf4-

PDB Compounds: (A:) G alpha i/12

SCOPe Domain Sequences for d1zcaa1:

Sequence; same for both SEQRES and ATOM records:

>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
fdqkallefrdtifdnilkgsrvlvdardklgipwqhsenekhgmflmafenkaglpvep
atfqlyvpalsalwrdsgireafsrrsefqlgesvkyfldnldrigqlnyfpskqdilla
rk

Timeline for d1zcaa1:

• d1zcaa1 first appeared in SCOP 1.73
  
• d1zcaa1 appears in SCOPe 2.07