SCOP 1.75: Domain d1zala1: 1zal A:1-363

Lineage for d1zala1 (1zal A:1-363)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species)

7. Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (15 PDB entries)

8. Domain d1zala1: 1zal A:1-363 [124836]
   automatically matched to 1ZAH A:1-363
   complexed with po4

Details for d1zala1

PDB Entry: 1zal, 1.89 Å

PDB Description: fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with partially disordered tagatose-1,6-bisphosphate, a weak competitive inhibitor

PDB Compounds: (A:) Fructose-bisphosphate aldolase A

SCOP Domain Sequences for d1zala1:

Sequence; same for both SEQRES and ATOM records:

>d1zala1 c.1.10.1 (A:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
hay

Timeline for d1zala1:

• d1zala1 first appeared in SCOP 1.73
  
• d1zala1 is called d1zala_ in SCOPe 2.01
  
• d1zala1 appears in the current release, SCOPe 2.08, called d1zala_