Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species) |
Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (15 PDB entries) |
Domain d1zala1: 1zal A:1-363 [124836] automatically matched to 1ZAH A:1-363 complexed with po4 |
PDB Entry: 1zal (more details), 1.89 Å
SCOP Domain Sequences for d1zala1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zala1 c.1.10.1 (A:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]} phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn hay
Timeline for d1zala1: