Lineage for d1zabc1 (1zab C:10-144)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711877Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 711878Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 711879Family c.97.1.1: Cytidine deaminase [53928] (3 proteins)
    strand 5 is antiparallel to strand 4
  6. 711888Protein mono-domain cytidine deaminase [75327] (5 species)
  7. 711911Species Mouse (Mus musculus) [TaxId:10090] [142830] (3 PDB entries)
  8. 711922Domain d1zabc1: 1zab C:10-144 [124820]
    automatically matched to 1ZAB A:10-146
    complexed with so4, urd, zn

Details for d1zabc1

PDB Entry: 1zab (more details), 2.36 Å

PDB Description: Crystal Structure of Mouse Cytidine Deaminase Complexed with 3-Deazauridine
PDB Compounds: (C:) Cytidine deaminase

SCOP Domain Sequences for d1zabc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zabc1 c.97.1.1 (C:10-144) mono-domain cytidine deaminase {Mouse (Mus musculus) [TaxId: 10090]}
vepehvqrlllssreakksaycpysrfpvgaalltgdgrifsgcnienacyplgvcaert
aiqkaisegykdfraiaissdlqeefispcgacrqvmrefgtdwavymtkpdgtfvvrtv
qellpasfgpedlqk

SCOP Domain Coordinates for d1zabc1:

Click to download the PDB-style file with coordinates for d1zabc1.
(The format of our PDB-style files is described here.)

Timeline for d1zabc1: