Lineage for d1z9ce1 (1z9c E:8-144)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635444Family a.4.5.28: MarR-like transcriptional regulators [63379] (16 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 635461Protein Organic hydroperoxide resistance transcriptional regulator OhrR [140247] (1 species)
  7. 635462Species Bacillus subtilis [TaxId:1423] [140248] (2 PDB entries)
  8. 635468Domain d1z9ce1: 1z9c E:8-144 [124751]
    automatically matched to 1Z91 A:8-144
    mutant

Details for d1z9ce1

PDB Entry: 1z9c (more details), 2.64 Å

PDB Description: crystal structure of ohrr bound to the ohra promoter: structure of marr family protein with operator dna
PDB Compounds: (E:) Organic hydroperoxide resistance transcriptional regulator

SCOP Domain Sequences for d1z9ce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z9ce1 a.4.5.28 (E:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]}
mklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyld
sgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsge
dlkqlksalytlletlh

SCOP Domain Coordinates for d1z9ce1:

Click to download the PDB-style file with coordinates for d1z9ce1.
(The format of our PDB-style files is described here.)

Timeline for d1z9ce1: