SCOP 1.73: Domain d1z9cb1: 1z9c B:8-144

Lineage for d1z9cb1 (1z9c B:8-144)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (16 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Organic hydroperoxide resistance transcriptional regulator OhrR [140247] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140248] (2 PDB entries)

8. Domain d1z9cb1: 1z9c B:8-144 [124748]
   automatically matched to 1Z91 A:8-144
   mutant

Details for d1z9cb1

PDB Entry: 1z9c, 2.64 Å

PDB Description: crystal structure of ohrr bound to the ohra promoter: structure of marr family protein with operator dna

PDB Compounds: (B:) Organic hydroperoxide resistance transcriptional regulator

SCOP Domain Sequences for d1z9cb1:

Sequence; same for both SEQRES and ATOM records:

>d1z9cb1 a.4.5.28 (B:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]}
mklenqlsfllyassremtkqykplldklnitypqylallllwehetltvkkmgeqlyld
sgtltpmlkrmeqqglitrkrseedersvlisltedgallkekavdipgtilglskqsge
dlkqlksalytlletlh

Timeline for d1z9cb1:

• d1z9cb1 is new in SCOP 1.73
  
• d1z9cb1 appears in SCOP 1.75
  
• d1z9cb1 appears in the current release, SCOPe 2.08, called d1z9cb_