Lineage for d1z94e_ (1z94 E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539012Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2539232Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
    Pfam PF05146
  6. 2539248Protein Hypothetical protein CV1439 [143835] (1 species)
  7. 2539249Species Chromobacterium violaceum [TaxId:536] [143836] (1 PDB entry)
    Uniprot Q7NY36 2-144
  8. 2539254Domain d1z94e_: 1z94 E: [124744]
    automated match to d1z94a1

Details for d1z94e_

PDB Entry: 1z94 (more details), 2.1 Å

PDB Description: X-Ray Crystal Structure of Protein CV1439 from Chromobacterium violaceum. Northeast Structural Genomics Consortium Target CvR12.
PDB Compounds: (E:) conserved hypothetical protein

SCOPe Domain Sequences for d1z94e_:

Sequence, based on SEQRES records: (download)

>d1z94e_ d.129.3.5 (E:) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]}
pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
gqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipdai
ppencylgwqqslkqlaalvepd

Sequence, based on observed residues (ATOM records): (download)

>d1z94e_ d.129.3.5 (E:) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]}
pntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafas
gqkhafggrylelvpgerirytdrfdgdmittitlaplscgadlsivqegipdaippenc
ylgwqqslkqlaalvepd

SCOPe Domain Coordinates for d1z94e_:

Click to download the PDB-style file with coordinates for d1z94e_.
(The format of our PDB-style files is described here.)

Timeline for d1z94e_: