SCOPe 2.08: Domain d1z94b_: 1z94 B:

Lineage for d1z94b_ (1z94 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
   Pfam PF05146

6. Protein Hypothetical protein CV1439 [143835] (1 species)

7. Species Chromobacterium violaceum [TaxId:536] [143836] (1 PDB entry)
   Uniprot Q7NY36 2-144

8. Domain d1z94b_: 1z94 B: [124741]
   automated match to d1z94a1

Details for d1z94b_

PDB Entry: 1z94, 2.1 Å

PDB Description: X-Ray Crystal Structure of Protein CV1439 from Chromobacterium violaceum. Northeast Structural Genomics Consortium Target CvR12.

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1z94b_:

Sequence; same for both SEQRES and ATOM records:

>d1z94b_ d.129.3.5 (B:) Hypothetical protein CV1439 {Chromobacterium violaceum [TaxId: 536]}
mpntirlhrvlsappervyrafldplalakwlppegfvckvlehdarvggaykmeflafa
sgqkhafggrylelvpgerirytdrfddaglpgdmittitlaplscgadlsivqegipda
ippencylgwqqslkqlaalvepd

Timeline for d1z94b_:

• d1z94b_ first appeared in SCOP 1.73, called d1z94b1
  
• d1z94b_ appears in SCOPe 2.07