SCOPe 2.03: Domain d1z92b2: 1z92 B:104-165

Lineage for d1z92b2 (1z92 B:104-165)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein Interleukin-2 receptor alpha chain [144117] (1 species)
   consists of two segment-swapped SCR domains

7. Species Human (Homo sapiens) [TaxId:9606] [144118] (4 PDB entries)
   Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85

8. Domain d1z92b2: 1z92 B:104-165 [124739]
   Other proteins in same PDB: d1z92a_

Details for d1z92b2

PDB Entry: 1z92, 2.8 Å

PDB Description: structure of interleukin-2 with its alpha receptor

PDB Compounds: (B:) Interleukin-2 receptor alpha chain

SCOPe Domain Sequences for d1z92b2:

Sequence; same for both SEQRES and ATOM records:

>d1z92b2 g.18.1.1 (B:104-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
crepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqpqlic
tg

Timeline for d1z92b2:

• d1z92b2 first appeared in SCOP 1.73
  
• d1z92b2 appears in SCOPe 2.02
  
• d1z92b2 appears in SCOPe 2.04
  
• d1z92b2 appears in the current release, SCOPe 2.08