SCOPe 2.07: Domain d1z8kb_: 1z8k B:

Lineage for d1z8kb_ (1z8k B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families)

5. Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
   Pfam PF06351

6. Protein Allene oxide cyclase, AOC [141495] (2 species)

7. Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
   Uniprot Q9LS02 80-253

8. Domain d1z8kb_: 1z8k B: [124704]
   automated match to d1z8ka1

Details for d1z8kb_

PDB Entry: 1z8k, 1.71 Å

PDB Description: x-ray structure of allene oxide cyclase from arabidopsis thaliana at3g25770

PDB Compounds: (B:) At3g25770 protein

SCOPe Domain Sequences for d1z8kb_:

Sequence; same for both SEQRES and ATOM records:

>d1z8kb_ b.159.1.1 (B:) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

Timeline for d1z8kb_:

• d1z8kb_ first appeared in SCOP 1.73, called d1z8kb1
  
• d1z8kb_ appears in SCOPe 2.06
  
• d1z8kb_ appears in the current release, SCOPe 2.08