| Class b: All beta proteins [48724] (178 folds) |
| Fold b.159: AOC barrel-like [141492] (2 superfamilies) barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds |
Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) ![]() |
| Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins) Pfam PF06351 |
| Protein Allene oxide cyclase, AOC [141495] (2 species) |
| Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries) Uniprot Q9LS02 80-253 |
| Domain d1z8kb_: 1z8k B: [124704] automated match to d1z8ka1 |
PDB Entry: 1z8k (more details), 1.71 Å
SCOPe Domain Sequences for d1z8kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8kb_ b.159.1.1 (B:) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
Timeline for d1z8kb_: