Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Hepsin, catalytic domain [101813] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101814] (4 PDB entries) Uniprot P05981 163-417 |
Domain d1z8ga1: 1z8g A:163-417 [124697] Other proteins in same PDB: d1z8ga2 automatically matched to d1o5eh_ complexed with ace, mai; mutant |
PDB Entry: 1z8g (more details), 1.55 Å
SCOP Domain Sequences for d1z8ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq aikthseasgmvtql
Timeline for d1z8ga1: