SCOP 1.75: Domain d1z8ga1: 1z8g A:163-417

Lineage for d1z8ga1 (1z8g A:163-417)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Hepsin, catalytic domain [101813] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101814] (4 PDB entries)
   Uniprot P05981 163-417

8. Domain d1z8ga1: 1z8g A:163-417 [124697]
   Other proteins in same PDB: d1z8ga2
   automatically matched to d1o5eh_
   complexed with ace, mai; mutant

Details for d1z8ga1

PDB Entry: 1z8g, 1.55 Å

PDB Description: crystal structure of the extracellular region of the transmembrane serine protease hepsin with covalently bound preferred substrate.

PDB Compounds: (A:) Serine protease hepsin

SCOP Domain Sequences for d1z8ga1:

Sequence; same for both SEQRES and ATOM records:

>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ivggrdtslgrwpwqvslrydgahlcggsllsgdwvltaahcfpernrvlsrwrvfagav
aqasphglqlgvqavvyhggylpfrdpnseensndialvhlssplplteyiqpvclpaag
qalvdgkictvtgwgntqyygqqagvlqearvpiisndvcngadfygnqikpkmfcagyp
eggidacqgdsggpfvcedsisrtprwrlcgivswgtgcalaqkpgvytkvsdfrewifq
aikthseasgmvtql

Timeline for d1z8ga1:

• d1z8ga1 first appeared in SCOP 1.73
  
• d1z8ga1 appears in SCOPe 2.01
  
• d1z8ga1 appears in the current release, SCOPe 2.08