![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.2: Hexose-1-phosphate uridylyltransferase [54207] (1 protein) duplication: consists of 2 HIT-like motifs binds zinc and iron ions |
![]() | Protein Galactose-1-phosphate uridylyltransferase [54208] (3 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110788] (5 PDB entries) Uniprot Q9FK51 |
![]() | Domain d1z84b2: 1z84 B:196-350 [124689] automatically matched to d1vkva2 complexed with amp, edo, zn |
PDB Entry: 1z84 (more details), 1.83 Å
SCOPe Domain Sequences for d1z84b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z84b2 d.13.1.2 (B:196-350) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} pptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapfaatypfeiwiipkdh sshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplkvtesqlpythwflqi vpqlsgvggfeigtgcyinpvfpedvakvmrevsl
Timeline for d1z84b2: