PDB entry 1z84

View 1z84 on RCSB PDB site
Description: X-ray structure of galt-like protein from arabidopsis thaliana at5g18200
Class: structural genomics, unknown function
Keywords: galt, zinc, amp, structural genomics, protein structure initiative, psi, cesg, center for eukaryotic structural genomics, unknown function
Deposited on 2005-03-29, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactose-1-phosphate uridyl transferase-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g18200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z84a1, d1z84a2
  • Chain 'B':
    Compound: galactose-1-phosphate uridyl transferase-like protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g18200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1z84b1, d1z84b2
  • Heterogens: ZN, AMP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z84A (A:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifsparakrptdfkskspqnpnpkp
    sscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z84A (A:)
    spelrkdpvtnrwvifsprptdfkskspsscpfcigreqecapelfrvpdhdpnwklrvi
    enlypalsrnletqsrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqia
    qhdsinyiqvfknqgasagasmshshsqmmalpvvpptvssrldgtkdyfeetgkcclce
    akskhfvidesshfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklmlqk
    iakqlndppynymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfped
    vakvmrevslt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1z84B (B:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifsparakrptdfkskspqnpnpkp
    sscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z84B (B:)
    qspelrkdpvtnrwvifsptdfksscpfcigreqecapelfrvpdhdpnwklrvienlyp
    alsrnletqsrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsi
    nyiqvfknqgasagasmshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskh
    fvidesshfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakql
    ndppynymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvm
    revsl